PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G121200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WRKY
Protein Properties Length: 180aa    MW: 20415.5 Da    PI: 7.6614
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G121200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.13.6e-3388146159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vk+s+fprsYY+Ct++gC+vkk+v+r+++++++v++tYeg H+h+
  Manes.06G121200.1.p  88 LDDGYRWRKYGQKTVKNSKFPRSYYKCTHSGCNVKKQVQRNSNNEEIVVTTYEGMHTHP 146
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-3375146IPR003657WRKY domain
SuperFamilySSF1182901.83E-2980147IPR003657WRKY domain
PROSITE profilePS5081129.95383148IPR003657WRKY domain
SMARTSM007742.7E-3888147IPR003657WRKY domain
PfamPF031061.7E-2789146IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MESHEIFLPA GSSLGPSTYS SSLQMQMANP GTQFSGKDGS WISSEKSTSH HQSGSSSSTS  60
EKFEGDNENK EIIRHRYAFQ TRSQIDILDD GYRWRKYGQK TVKNSKFPRS YYKCTHSGCN  120
VKKQVQRNSN NEEIVVTTYE GMHTHPTEIC SDNFEEIILR QMQTYKLLSD THAGITNRE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2778145774Probable WRKY transcription factor 4
2lex_A1e-2778145774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8275980.0KT827598.1 Manihot esculenta WRKY transcription factor 23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090665.12e-61PREDICTED: probable WRKY transcription factor 75 isoform X1
SwissprotQ9FYA21e-46WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A140H8M71e-133A0A140H8M7_MANES; WRKY transcription factor 23
STRINGPOPTR_0012s10290.12e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.17e-47WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Wei Y, et al.
    Genome-Wide Identification and Expression Analysis of the WRKY Gene Family in Cassava.
    Front Plant Sci, 2016. 7: p. 25
    [PMID:26904033]